Claude Market
Menu
SkillsMCPPluginsSubmit MCPSkillPluginMCPMCP, plugin, or skillAdvertise
Claude Market
SkillsMCPPluginsSubmit MCPSkillPluginMCPMCP, plugin, or skillAdvertise

Featured

Deploy OpenClaw in 60 seconds — 20% off logoDeploy OpenClaw in 60 seconds — 20% off

Launch OpenClaw on Hostinger in about 60 seconds and keep your agent live 24/7. Our referral link gives you 20% off, no coupon code needed.

Launch on Hostinger →
Run your Hermes agent on Hostinger, fully managed logoRun your Hermes agent on Hostinger, fully managed

Launch Hermes on Hostinger in one click, fully managed, no VPS knowledge needed. Use code ZACAARON10 for 10% off.

Launch on Hostinger →
Crawl and scrape any site into clean data, 10% off logoCrawl and scrape any site into clean data, 10% off

Firecrawl crawls and scrapes any site into clean markdown for your agent. Get 1,000 free credits, and new users get 10% off their first purchase.

Try Firecrawl free →
Your own AI agent, running 24/7 with QwikClaw logoYour own AI agent, running 24/7 with QwikClaw

QwikClaw sets up and runs an always-on OpenClaw agent for you. One click, no config files, no server setup.

Deploy now →
One API to scrape, enrich, and extract the internet. logoOne API to scrape, enrich, and extract the internet.

Context.dev gives your agents a single API to scrape, enrich, and extract live web data — no proxies, no parsers, no maintenance.

Start building free →
SetupClaw: done-for-you OpenClaw for founders & exec teams logoSetupClaw: done-for-you OpenClaw for founders & exec teams

White-glove OpenClaw for founders and exec teams (4–50+ employees): we install, harden, integrate your tools, and maintain it — secured from day one.

Get it set up for you →
SEO data APIs for your agent, $1 free credit logoSEO data APIs for your agent, $1 free credit

DataForSEO gives your agent live access to SERP results, keyword data, backlinks, and on-page SEO data through one API. New accounts get a $1 credit, good for up to 20,000 keyword or backlink lookups.

Try DataForSEO free →
Reach 47,000+ AI builders

A flat monthly placement in front of developers actively installing AI tools. No lock-in, cancel anytime.

Advertise here →
Deploy OpenClaw in 60 seconds — 20% off logoDeploy OpenClaw in 60 seconds — 20% off

Launch OpenClaw on Hostinger in about 60 seconds and keep your agent live 24/7. Our referral link gives you 20% off, no coupon code needed.

Launch on Hostinger →
Run your Hermes agent on Hostinger, fully managed logoRun your Hermes agent on Hostinger, fully managed

Launch Hermes on Hostinger in one click, fully managed, no VPS knowledge needed. Use code ZACAARON10 for 10% off.

Launch on Hostinger →
Crawl and scrape any site into clean data, 10% off logoCrawl and scrape any site into clean data, 10% off

Firecrawl crawls and scrapes any site into clean markdown for your agent. Get 1,000 free credits, and new users get 10% off their first purchase.

Try Firecrawl free →
Your own AI agent, running 24/7 with QwikClaw logoYour own AI agent, running 24/7 with QwikClaw

QwikClaw sets up and runs an always-on OpenClaw agent for you. One click, no config files, no server setup.

Deploy now →
One API to scrape, enrich, and extract the internet. logoOne API to scrape, enrich, and extract the internet.

Context.dev gives your agents a single API to scrape, enrich, and extract live web data — no proxies, no parsers, no maintenance.

Start building free →
SetupClaw: done-for-you OpenClaw for founders & exec teams logoSetupClaw: done-for-you OpenClaw for founders & exec teams

White-glove OpenClaw for founders and exec teams (4–50+ employees): we install, harden, integrate your tools, and maintain it — secured from day one.

Get it set up for you →
SEO data APIs for your agent, $1 free credit logoSEO data APIs for your agent, $1 free credit

DataForSEO gives your agent live access to SERP results, keyword data, backlinks, and on-page SEO data through one API. New accounts get a $1 credit, good for up to 20,000 keyword or backlink lookups.

Try DataForSEO free →
Reach 47,000+ AI builders

A flat monthly placement in front of developers actively installing AI tools. No lock-in, cancel anytime.

Advertise here →
Deploy OpenClaw in 60 seconds — 20% off logoDeploy OpenClaw in 60 seconds — 20% off
Launch on Hostinger →
Run your Hermes agent on Hostinger, fully managed logoRun your Hermes agent on Hostinger, fully managed
Launch on Hostinger →
Crawl and scrape any site into clean data, 10% off logoCrawl and scrape any site into clean data, 10% off
Try Firecrawl free →
Your own AI agent, running 24/7 with QwikClaw logoYour own AI agent, running 24/7 with QwikClaw
Deploy now →
One API to scrape, enrich, and extract the internet. logoOne API to scrape, enrich, and extract the internet.
Start building free →
SetupClaw: done-for-you OpenClaw for founders & exec teams logoSetupClaw: done-for-you OpenClaw for founders & exec teams
Get it set up for you →
SEO data APIs for your agent, $1 free credit logoSEO data APIs for your agent, $1 free credit
Try DataForSEO free →
Reach 47,000+ AI builders
Advertise here →
Skills/k-dense-ai/scientific-agent-skills/glycoengineering
glycoengineering logo

glycoengineering

k-dense-ai/scientific-agent-skills
555 installs28K stars
Run it on Hostinger →up to 70% off + an extra 10% with code ZACAARON10Free API →

Installation

npx skills add https://github.com/k-dense-ai/scientific-agent-skills --skill glycoengineering

Summary

Analyze and engineer protein glycosylation. Scan sequences for N-glycosylation sequons (N-X-S/T), predict O-glycosylation hotspots, and access curated glycoengineering tools (NetOGlyc, GlycoShield, GlycoWorkbench). For glycoprotein engineering, therapeutic antibody optimization, and vaccine design.

SKILL.md

Glycoengineering

Overview

Glycosylation is the most common and complex post-translational modification (PTM) of proteins, affecting over 50% of all human proteins. Glycans regulate protein folding, stability, immune recognition, receptor interactions, and pharmacokinetics of therapeutic proteins. Glycoengineering involves rational modification of glycosylation patterns for improved therapeutic efficacy, stability, or immune evasion.

Two major glycosylation types:

  • N-glycosylation: Attached to asparagine (N) in the sequon N-X-[S/T] where X ≠ Proline; occurs in the ER/Golgi
  • O-glycosylation: Attached to serine (S) or threonine (T); no strict consensus motif; primarily GalNAc initiation

When to Use This Skill

Use this skill when:

  • Antibody engineering: Optimize Fc glycosylation for enhanced ADCC, CDC, or reduced immunogenicity
  • Therapeutic protein design: Identify glycosylation sites that affect half-life, stability, or immunogenicity
  • Vaccine antigen design: Engineer glycan shields to focus immune responses on conserved epitopes
  • Biosimilar characterization: Compare glycan patterns between reference and biosimilar
  • Drug target analysis: Does glycosylation affect target engagement for a receptor?
  • Protein stability: N-glycans often stabilize proteins; identify sites for stabilizing mutations

N-Glycosylation Sequon Analysis

Scanning for N-Glycosylation Sites

N-glycosylation occurs at the sequon N-X-[S/T] where X ≠ Proline.

import re
from typing import List, Tuple

def find_n_glycosylation_sequons(sequence: str) -> List[dict]:
    """
    Scan a protein sequence for canonical N-linked glycosylation sequons.
    Motif: N-X-[S/T], where X ≠ Proline.

    Args:
        sequence: Single-letter amino acid sequence

    Returns:
        List of dicts with position (1-based), motif, and context
    """
    seq = sequence.upper()
    results = []
    i = 0
    while i <= len(seq) - 3:
        triplet = seq[i:i+3]
        if triplet[0] == 'N' and triplet[1] != 'P' and triplet[2] in {'S', 'T'}:
            context = seq[max(0, i-3):i+6]  # ±3 residue context
            results.append({
                'position': i + 1,   # 1-based
                'motif': triplet,
                'context': context,
                'sequon_type': 'NXS' if triplet[2] == 'S' else 'NXT'
            })
            i += 3
        else:
            i += 1
    return results

def summarize_glycosylation_sites(sequence: str, protein_name: str = "") -> str:
    """Generate a research log summary of N-glycosylation sites."""
    sequons = find_n_glycosylation_sequons(sequence)

    lines = [f"# N-Glycosylation Sequon Analysis: {protein_name or 'Protein'}"]
    lines.append(f"Sequence length: {len(sequence)}")
    lines.append(f"Total N-glycosylation sequons: {len(sequons)}")

    if sequons:
        lines.append(f"\nN-X-S sites: {sum(1 for s in sequons if s['sequon_type'] == 'NXS')}")
        lines.append(f"N-X-T sites: {sum(1 for s in sequons if s['sequon_type'] == 'NXT')}")
        lines.append(f"\nSite details:")
        for s in sequons:
            lines.append(f"  Position {s['position']}: {s['motif']} (context: ...{s['context']}...)")
    else:
        lines.append("No canonical N-glycosylation sequons detected.")

    return "\n".join(lines)

# Example: IgG1 Fc region
fc_sequence = "APELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK"
print(summarize_glycosylation_sites(fc_sequence, "IgG1 Fc"))

Mutating N-Glycosylation Sites

def eliminate_glycosite(sequence: str, position: int, replacement: str = "Q") -> str:
    """
    Eliminate an N-glycosylation site by substituting Asn → Gln (conservative).

    Args:
        sequence: Protein sequence
        position: 1-based position of the Asn to mutate
        replacement: Amino acid to substitute (default Q = Gln; similar size, not glycosylated)

    Returns:
        Mutated sequence
    """
    seq = list(sequence.upper())
    idx = position - 1
    assert seq[idx] == 'N', f"Position {position} is '{seq[idx]}', not 'N'"
    seq[idx] = replacement.upper()
    return ''.join(seq)

def add_glycosite(sequence: str, position: int, flanking_context: str = "S") -> str:
    """
    Introduce an N-glycosylation site by mutating a residue to Asn,
    and ensuring X ≠ Pro and +2 = S/T.

    Args:
        position: 1-based position to introduce Asn
        flanking_context: 'S' or 'T' at position+2 (if modification needed)
    """
    seq = list(sequence.upper())
    idx = position - 1

    # Mutate to Asn
    seq[idx] = 'N'

    # Ensure X+1 != Pro (mutate to Ala if needed)
    if idx + 1 < len(seq) and seq[idx + 1] == 'P':
        seq[idx + 1] = 'A'

    # Ensure X+2 = S or T
    if idx + 2 < len(seq) and seq[idx + 2] not in ('S', 'T'):
        seq[idx + 2] = flanking_context

    return ''.join(seq)

O-Glycosylation Analysis

Heuristic O-Glycosylation Hotspot Prediction

def predict_o_glycosylation_hotspots(
    sequence: str,
    window: int = 7,
    min_st_fraction: float = 0.4,
    disallow_proline_next: bool = True
) -> List[dict]:
    """
    Heuristic O-glycosylation hotspot scoring based on local S/T density.
    Not a substitute for NetOGlyc; use as fast baseline.

    Rules:
    - O-GalNAc glycosylation clusters on Ser/Thr-rich segments
    - Flag Ser/Thr residues in windows enriched for S/T
    - Avoid S/T immediately followed by Pro (TP/SP motifs inhibit GalNAc-T)

    Args:
        window: Odd window size for local S/T density
        min_st_fraction: Minimum fraction of S/T in window to flag site
    """
    if window % 2 == 0:
        window = 7
    seq = sequence.upper()
    half = window // 2
    candidates = []

    for i, aa in enumerate(seq):
        if aa not in ('S', 'T'):
            continue
        if disallow_proline_next and i + 1 < len(seq) and seq[i+1] == 'P':
            continue

        start = max(0, i - half)
        end = min(len(seq), i + half + 1)
        segment = seq[start:end]
        st_count = sum(1 for c in segment if c in ('S', 'T'))
        frac = st_count / len(segment)

        if frac >= min_st_fraction:
            candidates.append({
                'position': i + 1,
                'residue': aa,
                'st_fraction': round(frac, 3),
                'window': f"{start+1}-{end}",
                'segment': segment
            })

    return candidates

External Glycoengineering Tools

1. NetOGlyc 4.0 (O-glycosylation prediction)

Web service for high-accuracy O-GalNAc site prediction:

  • URL: https://services.healthtech.dtu.dk/services/NetOGlyc-4.0/
  • Input: FASTA protein sequence
  • Output: Per-residue O-glycosylation probability scores
  • Method: Neural network trained on experimentally verified O-GalNAc sites
import requests

def submit_netoglycv4(fasta_sequence: str) -> str:
    """
    Submit sequence to NetOGlyc 4.0 web service.
    Returns the job URL for result retrieval.

    Note: This uses the DTU Health Tech web service. Results take ~1-5 min.
    """
    url = "https://services.healthtech.dtu.dk/cgi-bin/webface2.cgi"
    # NetOGlyc submission (parameters may vary with web service version)
    # Recommend using the web interface directly for most use cases
    print("Submit sequence at: https://services.healthtech.dtu.dk/services/NetOGlyc-4.0/")
    return url

# Also: NetNGlyc for N-glycosylation prediction
# URL: https://services.healthtech.dtu.dk/services/NetNGlyc-1.0/

2. GlycoShield-MD (Glycan Shielding Analysis)

GlycoShield-MD analyzes how glycans shield protein surfaces during MD simulations:

  • URL: https://gitlab.mpcdf.mpg.de/dioscuri-biophysics/glycoshield-md/
  • Use: Map glycan shielding on protein surface over MD trajectory
  • Output: Per-residue shielding fraction, visualization
# Installation
pip install glycoshield

# Basic usage: analyze glycan shielding from glycosylated protein MD trajectory
glycoshield \
    --topology glycoprotein.pdb \
    --trajectory glycoprotein.xtc \
    --glycan_resnames BGLCNA FUC \
    --output shielding_analysis/

3. GlycoWorkbench (Glycan Structure Drawing/Analysis)

  • URL: https://www.eurocarbdb.org/project/glycoworkbench
  • Use: Draw glycan structures, calculate masses, annotate MS spectra
  • Format: GlycoCT, IUPAC condensed glycan notation

4. GlyConnect (Glycan-Protein Database)

  • URL: https://glyconnect.expasy.org/
  • Use: Find experimentally verified glycoproteins and glycosylation sites
  • Query: By protein (UniProt ID), glycan structure, or tissue
import requests

def query_glyconnect(uniprot_id: str) -> dict:
    """Query GlyConnect for glycosylation data for a protein."""
    url = f"https://glyconnect.expasy.org/api/proteins/uniprot/{uniprot_id}"
    response = requests.get(url, headers={"Accept": "application/json"})
    if response.status_code == 200:
        return response.json()
    return {}

# Example: query EGFR glycosylation
egfr_glyco = query_glyconnect("P00533")

5. UniCarbKB (Glycan Structure Database)

  • URL: https://unicarbkb.org/
  • Use: Browse glycan structures, search by mass or composition
  • Format: GlycoCT or IUPAC notation

Key Glycoengineering Strategies

For Therapeutic Antibodies

GoalStrategyNotes
Enhance ADCCDefucosylation at Fc Asn297Afucosylated IgG1 has ~50× better FcγRIIIa binding
Reduce immunogenicityRemove non-human glycansEliminate α-Gal, NGNA epitopes
Improve PK half-lifeSialylationSialylated glycans extend half-life
Reduce inflammationHypersialylationIVIG anti-inflammatory mechanism
Create glycan shieldAdd N-glycosites to surfaceMasks vulnerable epitopes (vaccine design)

Common Mutations Used

MutationEffect
N297A/Q (IgG1)Removes Fc glycosylation (aglycosyl)
N297D (IgG1)Removes Fc glycosylation
S298A/E333A/K334AIncreases FcγRIIIa binding
F243L (IgG1)Increases defucosylation
T299ARemoves Fc glycosylation

Glycan Notation

IUPAC Condensed Notation (Monosaccharide abbreviations)

SymbolFull NameType
GlcGlucoseHexose
GlcNAcN-AcetylglucosamineHexNAc
ManMannoseHexose
GalGalactoseHexose
FucFucoseDeoxyhexose
Neu5AcN-Acetylneuraminic acid (Sialic acid)Sialic acid
GalNAcN-AcetylgalactosamineHexNAc

Complex N-Glycan Structure

Typical complex biantennary N-glycan:
Neu5Ac-Gal-GlcNAc-Man\
                       Man-GlcNAc-GlcNAc-[Asn]
Neu5Ac-Gal-GlcNAc-Man/
(±Core Fuc at innermost GlcNAc)

Best Practices

  • Start with NetNGlyc/NetOGlyc for computational prediction before experimental validation
  • Verify with mass spectrometry: Glycoproteomics (Byonic, Mascot) for site-specific glycan profiling
  • Consider site context: Not all predicted sequons are actually glycosylated (accessibility, cell type, protein conformation)
  • For antibodies: Fc N297 glycan is critical — always characterize this site first
  • Use GlyConnect to check if your protein of interest has experimentally verified glycosylation data

Additional Resources

  • GlyTouCan (glycan structure repository): https://glytoucan.org/
  • GlyConnect: https://glyconnect.expasy.org/
  • CFG Functional Glycomics: http://www.functionalglycomics.org/
  • DTU Health Tech servers (NetNGlyc, NetOGlyc): https://services.healthtech.dtu.dk/
  • GlycoWorkbench: https://glycoworkbench.software.informer.com/
  • Review: Apweiler R et al. (1999) Biochim Biophys Acta. PMID: 10564035
  • Therapeutic glycoengineering review: Jefferis R (2009) Nature Reviews Drug Discovery. PMID: 19448661

Score

0–100
65/ 100

Grade

C

Popularity17/30

555 installs — growing adoption. Source repo has 28,196 GitHub stars.

Completeness27/30

Documented: full SKILL.md body, description, one-line install. Missing: category/license metadata.

Trust15/25

Community skill with a public GitHub source repository you can review.

Freshness6/15

No update timestamp is tracked for this skill in our catalog.

Scored automatically from popularity, completeness, trust, and freshness — computed only from data in our catalog, never fabricated.

Proud of your score? Add this badge to your README.

Paste a snippet into your GitHub README. The badge updates automatically and links back to this page.

Glycoengineering skill score badge previewScore badge

Markdown

[![Glycoengineering skill](https://www.claudemarket.ai/skills/k-dense-ai/scientific-agent-skills/glycoengineering/badges/score.svg)](https://www.claudemarket.ai/skills/k-dense-ai/scientific-agent-skills/glycoengineering)

HTML

<a href="https://www.claudemarket.ai/skills/k-dense-ai/scientific-agent-skills/glycoengineering"><img src="https://www.claudemarket.ai/skills/k-dense-ai/scientific-agent-skills/glycoengineering/badges/score.svg" alt="Glycoengineering skill"/></a>

Glycoengineering FAQ

How do I install the Glycoengineering skill?

Run “npx skills add https://github.com/k-dense-ai/scientific-agent-skills --skill glycoengineering” in your terminal. The skill is added to your agent's skills directory and picked up automatically on the next run — no restart or extra configuration needed.

What does the Glycoengineering skill do?

Analyze and engineer protein glycosylation. Scan sequences for N-glycosylation sequons (N-X-S/T), predict O-glycosylation hotspots, and access curated glycoengineering tools (NetOGlyc, GlycoShield, GlycoWorkbench). For glycoprotein engineering, therapeutic antibody optimization, and vaccine design. The full SKILL.md on this page shows the exact instructions the skill gives your agent.

Is the Glycoengineering skill free?

Yes. Glycoengineering is a free, open-source skill published from k-dense-ai/scientific-agent-skills. As with any third-party skill, review the source repository before installing it into an agent with sensitive access.

Does Glycoengineering work with Claude Code and OpenClaw?

Yes. Skills use the portable SKILL.md format, so Glycoengineering works with Claude Code, OpenClaw, Codex, Hermes, and any other agent that reads SKILL.md skills.

Featured

Deploy OpenClaw in 60 seconds — 20% off logoDeploy OpenClaw in 60 seconds — 20% off

Launch OpenClaw on Hostinger in about 60 seconds and keep your agent live 24/7. Our referral link gives you 20% off, no coupon code needed.

Launch on Hostinger →
Run your Hermes agent on Hostinger, fully managed logoRun your Hermes agent on Hostinger, fully managed

Launch Hermes on Hostinger in one click, fully managed, no VPS knowledge needed. Use code ZACAARON10 for 10% off.

Launch on Hostinger →
Crawl and scrape any site into clean data, 10% off logoCrawl and scrape any site into clean data, 10% off

Firecrawl crawls and scrapes any site into clean markdown for your agent. Get 1,000 free credits, and new users get 10% off their first purchase.

Try Firecrawl free →
Your own AI agent, running 24/7 with QwikClaw logoYour own AI agent, running 24/7 with QwikClaw

QwikClaw sets up and runs an always-on OpenClaw agent for you. One click, no config files, no server setup.

Deploy now →
One API to scrape, enrich, and extract the internet. logoOne API to scrape, enrich, and extract the internet.

Context.dev gives your agents a single API to scrape, enrich, and extract live web data — no proxies, no parsers, no maintenance.

Start building free →
SetupClaw: done-for-you OpenClaw for founders & exec teams logoSetupClaw: done-for-you OpenClaw for founders & exec teams

White-glove OpenClaw for founders and exec teams (4–50+ employees): we install, harden, integrate your tools, and maintain it — secured from day one.

Get it set up for you →
SEO data APIs for your agent, $1 free credit logoSEO data APIs for your agent, $1 free credit

DataForSEO gives your agent live access to SERP results, keyword data, backlinks, and on-page SEO data through one API. New accounts get a $1 credit, good for up to 20,000 keyword or backlink lookups.

Try DataForSEO free →
Reach 47,000+ AI builders

A flat monthly placement in front of developers actively installing AI tools. No lock-in, cancel anytime.

Advertise here →
Deploy OpenClaw in 60 seconds — 20% off logoDeploy OpenClaw in 60 seconds — 20% off

Launch OpenClaw on Hostinger in about 60 seconds and keep your agent live 24/7. Our referral link gives you 20% off, no coupon code needed.

Launch on Hostinger →
Run your Hermes agent on Hostinger, fully managed logoRun your Hermes agent on Hostinger, fully managed

Launch Hermes on Hostinger in one click, fully managed, no VPS knowledge needed. Use code ZACAARON10 for 10% off.

Launch on Hostinger →
Crawl and scrape any site into clean data, 10% off logoCrawl and scrape any site into clean data, 10% off

Firecrawl crawls and scrapes any site into clean markdown for your agent. Get 1,000 free credits, and new users get 10% off their first purchase.

Try Firecrawl free →
Your own AI agent, running 24/7 with QwikClaw logoYour own AI agent, running 24/7 with QwikClaw

QwikClaw sets up and runs an always-on OpenClaw agent for you. One click, no config files, no server setup.

Deploy now →
One API to scrape, enrich, and extract the internet. logoOne API to scrape, enrich, and extract the internet.

Context.dev gives your agents a single API to scrape, enrich, and extract live web data — no proxies, no parsers, no maintenance.

Start building free →
SetupClaw: done-for-you OpenClaw for founders & exec teams logoSetupClaw: done-for-you OpenClaw for founders & exec teams

White-glove OpenClaw for founders and exec teams (4–50+ employees): we install, harden, integrate your tools, and maintain it — secured from day one.

Get it set up for you →
SEO data APIs for your agent, $1 free credit logoSEO data APIs for your agent, $1 free credit

DataForSEO gives your agent live access to SERP results, keyword data, backlinks, and on-page SEO data through one API. New accounts get a $1 credit, good for up to 20,000 keyword or backlink lookups.

Try DataForSEO free →
Reach 47,000+ AI builders

A flat monthly placement in front of developers actively installing AI tools. No lock-in, cancel anytime.

Advertise here →
Deploy OpenClaw in 60 seconds — 20% off logoDeploy OpenClaw in 60 seconds — 20% off
Launch on Hostinger →
Run your Hermes agent on Hostinger, fully managed logoRun your Hermes agent on Hostinger, fully managed
Launch on Hostinger →
Crawl and scrape any site into clean data, 10% off logoCrawl and scrape any site into clean data, 10% off
Try Firecrawl free →
Your own AI agent, running 24/7 with QwikClaw logoYour own AI agent, running 24/7 with QwikClaw
Deploy now →
One API to scrape, enrich, and extract the internet. logoOne API to scrape, enrich, and extract the internet.
Start building free →
SetupClaw: done-for-you OpenClaw for founders & exec teams logoSetupClaw: done-for-you OpenClaw for founders & exec teams
Get it set up for you →
SEO data APIs for your agent, $1 free credit logoSEO data APIs for your agent, $1 free credit
Try DataForSEO free →
Reach 47,000+ AI builders
Advertise here →
View on GitHub

Recommended skills

Browse all →
find-skills logo

find-skills

vercel-labs/skills

2.8M installsInstall
frontend-design logo

frontend-design

anthropics/skills

731K installsInstall
grill-me logo

grill-me

mattpocock/skills

727K installsInstall
grill-with-docs logo

grill-with-docs

mattpocock/skills

617K installsInstall
agent-browser logo

agent-browser

vercel-labs/agent-browser

612K installsInstall
vercel-react-best-practices logo

vercel-react-best-practices

vercel-labs/agent-skills

599K installsInstall

Related guides

Hand-picked reading to help you choose, install, and use agent skills.

Guide10 Openclaw Skills Every Nextjs Developer NeedsGuideBest Openclaw Skills 2026GuideHow To Evaluate Openclaw Skill Before Installing

Skills by category

FrontendBackend & APIsTesting & QASecurityDevOps & CI/CDMCP & ToolingAutomationData & Analysis+20 more

MCP servers by category

AI & MLDeveloper ToolsVector & MemoryFiles & DocsDatabasesFinance & PaymentsBrowser & ScrapingCommunication+8 more

Marketplaces by category

developmentproductivitycommunicationdesignsecuritydatabaseworkflowcompliance+34 more

Claude Market

AI agent skills directory, marketplace, and workflow hub for OpenClaw, Hermes Agent, Claude Code, Codex, and MCP-powered operator stacks.

Independent project, not affiliated with Anthropic.

Resources

  • Browse Skills
  • Browse MCP Servers
  • Browse Plugins

More

  • Submit a Tool
  • Advertise
  • Free Tools
  • API
  • Shipping
  • Contact
  • Terms
  • Privacy

Know a company that should advertise here? Refer them and earn 10% — up to $300 per referral.

© 2026 Claude Market
Fazier badgeFeatured on Twelve ToolsFeatured on Wired BusinessRemote OpenClaw - Featured on AI Agents DirectoryListed on Turbo0Featured on Uneed